Pisum_sativum_v1_Contig2190
Contig Overview
Unigenes
This contig is part of the following unigenes:
Relationships
The following EST feature(s) are a part of this contig:
Analyses
This contig is derived from or has results from the following analyses
Alignments
The following features are aligned
Homology
BLAST of Pisum_sativum_v1_Contig2190 vs. TrEMBL
Match: Q0E7L3_PEA (Putative glycine rich protein OS=Pisum sativum GN=grp1 PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 1.685e-7 Identity = 30/40 (75.00%), Postives = 35/40 (87.50%), Query Frame = -3 Query: 525 GLLSMFFLISSEVSAWDLAETSTNTKEEVVEKSDEINDAK 644 GLL+M +ISSEVSA +LAETSTN KEEV EKS+E+NDAK Sbjct: 11 GLLAMVLVISSEVSARELAETSTNAKEEVAEKSNEVNDAK 50
BLAST of Pisum_sativum_v1_Contig2190 vs. TrEMBL
Match: Q0E7L3_PEA (Putative glycine rich protein OS=Pisum sativum GN=grp1 PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 2.035e-7 Identity = 30/40 (75.00%), Postives = 35/40 (87.50%), Query Frame = -3 Query: 525 GLLSMFFLISSEVSAWDLAETSTNTKEEVVEKSDEINDAK 644 GLL+M +ISSEVSA +LAETSTN KEEV EKS+E+NDAK Sbjct: 11 GLLAMVLVISSEVSARELAETSTNAKEEVAEKSNEVNDAK 50
BLAST of Pisum_sativum_v1_Contig2190 vs. Medicago proteins
Match: IMGA|Medtr5g084570.1 (Cold and drought-regulated protein CORA (AHRD V1 *-*- Q07202) chr05_pseudomolecule_IMGAG_V3.5 35482078-35480956 E EGN_Mt100125 20100825) HSP 1 Score: 56.6102 bits (135), Expect = 1.145e-8 Identity = 28/40 (70.00%), Postives = 35/40 (87.50%), Query Frame = -3 Query: 525 GLLSMFFLISSEVSAWDLAETSTNTKEEVVEKSDEINDAK 644 GLL+M LISSEVSA DL ETS++ K+EVVEK++E+NDAK Sbjct: 11 GLLAMVLLISSEVSARDLTETSSDAKKEVVEKTNEVNDAK 50
BLAST of Pisum_sativum_v1_Contig2190 vs. Medicago proteins
Match: IMGA|Medtr5g084540.1 (Cold and drought-regulated protein CORA (AHRD V1 *-*- Q07202) chr05_pseudomolecule_IMGAG_V3.5 35465017-35463999 E EGN_Mt100125 20100825) HSP 1 Score: 55.4546 bits (132), Expect = 2.552e-8 Identity = 27/40 (67.50%), Postives = 35/40 (87.50%), Query Frame = -3 Query: 525 GLLSMFFLISSEVSAWDLAETSTNTKEEVVEKSDEINDAK 644 GLL+M LISSEVSA DL ET+++ K+EVVEK++E+NDAK Sbjct: 11 GLLAMVLLISSEVSARDLTETTSDAKKEVVEKTNEVNDAK 50
BLAST of Pisum_sativum_v1_Contig2190 vs. Medicago proteins
Match: IMGA|Medtr5g084460.1 (Cold and drought-regulated protein CORA (AHRD V1 *-*- Q07202) chr05_pseudomolecule_IMGAG_V3.5 35425319-35423828 E EGN_Mt100125 20100825) HSP 1 Score: 51.2174 bits (121), Expect = 4.812e-7 Identity = 28/40 (70.00%), Postives = 35/40 (87.50%), Query Frame = -3 Query: 525 GLLSMFFLISSEVSAWDLAETSTNTKEEVVEKSDEINDAK 644 GLL+M LISS +SA DL ETST+TK+EVVEK++E+NDAK Sbjct: 11 GLLAMA-LISSVMSARDLTETSTDTKKEVVEKTNEVNDAK 49 The following BLAST results are available for this feature:
BLAST of Pisum_sativum_v1_Contig2190 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of Pisum_sativum_v1_Contig2190 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 1
BLAST of Pisum_sativum_v1_Contig2190 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
contig sequence >Pisum_sativum_v1_Contig2190 ID=Pisum_sativum_v1_Contig2190; Name=Pisum_sativum_v1_Contig2190; organism=Pisum sativum; type=contig; length=646bpback to top |