GT619950
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT619950 vs. TrEMBL
Match: D7L0U0_ARALY (Transducin family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_479673 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 7.452e-10 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 583 TRNADHKVRFWDYQLKQKLGQATKQLTVPNVKAMRMNDDV 702 T +ADH+V+FWDYQ+KQK G+ATKQLTV NVK+M+MNDDV Sbjct: 504 TVSADHEVKFWDYQVKQKSGKATKQLTVSNVKSMKMNDDV 543
BLAST of GT619950 vs. TrEMBL
Match: Q9LVF2_ARATH (Genomic DNA, chromosome 3, P1 clone: MIL23 OS=Arabidopsis thaliana GN=At3g21540 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 6.309e-9 Identity = 28/40 (70.00%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 583 TRNADHKVRFWDYQLKQKLGQATKQLTVPNVKAMRMNDDV 702 T +ADH+V+FW+YQ+KQK G+ATK+LTV NVK+M+MNDDV Sbjct: 504 TVSADHEVKFWEYQVKQKSGKATKKLTVSNVKSMKMNDDV 543
BLAST of GT619950 vs. TAIR peptide
Match: AT3G21540.1 (| Symbols: | transducin family protein / WD-40 repeat family protein | chr3:7586100-7590856 REVERSE LENGTH=955) HSP 1 Score: 65.0846 bits (157), Expect = 4.300e-11 Identity = 28/40 (70.00%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 583 TRNADHKVRFWDYQLKQKLGQATKQLTVPNVKAMRMNDDV 702 T +ADH+V+FW+YQ+KQK G+ATK+LTV NVK+M+MNDDV Sbjct: 504 TVSADHEVKFWEYQVKQKSGKATKKLTVSNVKSMKMNDDV 543 The following BLAST results are available for this feature:
BLAST of GT619950 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 2
BLAST of GT619950 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT619950 ID=GT619950; Name=GT619950; organism=Lens culinaris; type=EST; length=704bpback to top |