GT626303
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT626303 vs. TrEMBL
Match: B7FI52_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 2.175e-10 Identity = 31/66 (46.97%), Postives = 45/66 (68.18%), Query Frame = 2 Query: 539 YTGNGKENGISNSGYPFFYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFTKTSKYGTSFLP 736 Y G G + + PF Y +AA++++LH+ NV LFFL+KDLHHGTK N++F+KT+ +FLP Sbjct: 77 YEGGGTDVNVGVGRSPFIY-NYAASETQLHDKPNVALFFLEKDLHHGTKLNLQFSKTTSNAATFLP 141
BLAST of GT626303 vs. TrEMBL
Match: C0L012_SOYBN (BURP domain protein 2 OS=Glycine max GN=BURP2 PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 4.535e-8 Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 2 Query: 536 IYTG-NGKENGISNSGYPFFYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFT--KTSKYGTSFLP 736 ++TG GK + + F Y +AA++++LH++ NV LFFL+KDLHHGTK N+ FT TS +FLP Sbjct: 94 VHTGPKGKPVHVGVGPHSPFDYNYAASETQLHDDPNVALFFLEKDLHHGTKLNLHFTIYYTSNVDATFLP 163
BLAST of GT626303 vs. TrEMBL
Match: C6TEF5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 5.013e-7 Identity = 27/51 (52.94%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 590 FYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFTK--TSKYGTSFLP 736 F Y +AA++++ H++ NV LFFL+KDLH+GTK N+ FT+ TS SFLP Sbjct: 131 FDYNYAASETQWHDDPNVALFFLEKDLHYGTKLNLHFTRYFTSSVDASFLP 181
BLAST of GT626303 vs. TrEMBL
Match: B2ZPK6_SOYBN (BURP domain-containing protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 5.013e-7 Identity = 27/51 (52.94%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 590 FYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFTK--TSKYGTSFLP 736 F Y +AA++++ H++ NV LFFL+KDLH+GTK N+ FT+ TS SFLP Sbjct: 131 FDYNYAASETQWHDDPNVALFFLEKDLHYGTKLNLHFTRYFTSSVDASFLP 181
BLAST of GT626303 vs. TrEMBL
Match: C6TI21_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 6.548e-7 Identity = 28/62 (45.16%), Postives = 40/62 (64.52%), Query Frame = 2 Query: 551 GKENGISNSGYPFFYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFTKTSKYGTSFLP 736 GK +S F Y +A+ +++LH++ NV LFFL+KDLH GTK N+ FT +S +FLP Sbjct: 97 GKPVHVSVGSKSPFNYIYASTETQLHDDPNVALFFLEKDLHPGTKLNLHFTTSSNIQATFLP 158
BLAST of GT626303 vs. TrEMBL
Match: C6TCE4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 6.548e-7 Identity = 25/37 (67.57%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 174 ILQLALVSTHSALPSQLYWKSKFPTTQMPKAITDLLY 284 +L +ALV+TH+ALP + YWKS PTT MPKAITD+LY Sbjct: 11 LLNIALVATHAALPPEAYWKSVLPTTPMPKAITDILY 47
BLAST of GT626303 vs. TrEMBL
Match: B9VSG5_SOYBN (BURP domain protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 6.548e-7 Identity = 28/62 (45.16%), Postives = 40/62 (64.52%), Query Frame = 2 Query: 551 GKENGISNSGYPFFYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFTKTSKYGTSFLP 736 GK +S F Y +A+ +++LH++ NV LFFL+KDLH GTK N+ FT +S +FLP Sbjct: 97 GKPVHVSVGSKSPFNYIYASTETQLHDDPNVALFFLEKDLHPGTKLNLHFTTSSNIQATFLP 158
BLAST of GT626303 vs. TAIR peptide
Match: AT5G25610.1 (| Symbols: RD22, ATRD22 | BURP domain-containing protein | chr5:8914498-8916684 REVERSE LENGTH=392) HSP 1 Score: 50.8322 bits (120), Expect = 8.975e-7 Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 2 Query: 590 FYYGFAANKSELHENSNVGLFFLKKDLHHGTKFNMKFTKTSKYG--TSFLP 736 F Y +AA +++LH++ N LFFL+KDL G + N++F YG T+FLP Sbjct: 156 FVYNYAAKETQLHDDPNAALFFLEKDLVRGKEMNVRFNAEDGYGGKTAFLP 206 The following BLAST results are available for this feature:
BLAST of GT626303 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 7
BLAST of GT626303 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT626303 ID=GT626303; Name=GT626303; organism=Lens culinaris; type=EST; length=738bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|