GT623399
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT623399 vs. TrEMBL
Match: B9H4J0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1079544 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.700e-8 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 4 TLKESTHLTAVGHPQHDGSNSRIYTTRYEMSYSGSGWKIVEGAVL 138 TLKEST LT HP+++ SN + YTTRYE+S S SGWKI EGA++ Sbjct: 723 TLKESTRLTDEVHPENNASNVKTYTTRYELSCSNSGWKITEGAIM 767
BLAST of GT623399 vs. TrEMBL
Match: D7U3Q2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_33.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022614001 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.900e-8 Identity = 29/46 (63.04%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 4 TLKESTHLTAVGHPQHDGSNSRIYTTRYEMSYSGSGWKIVEGAVLE 141 TL+ES LT HP+H+ S S YTTRYEMS + SGWKI EGAVL+ Sbjct: 754 TLEESARLTDTVHPEHNDSYSTTYTTRYEMSCNSSGWKITEGAVLK 799
BLAST of GT623399 vs. TrEMBL
Match: A5BDQ0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_009566 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.439e-7 Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 4 TLKESTHLTAVGHPQHDGSNSRIYTTRYEMSYSGSGWKIVEGAVLE 141 TL+ES LT H +H+ S S YTTRYEMS + SGWKI EGAVL+ Sbjct: 743 TLEESARLTDTXHQEHNDSYSTTYTTRYEMSCNNSGWKITEGAVLK 788
BLAST of GT623399 vs. TAIR peptide
Match: AT5G42480.1 (| Symbols: ARC6 | Chaperone DnaJ-domain superfamily protein | chr5:16985295-16988332 FORWARD LENGTH=801) HSP 1 Score: 54.6842 bits (130), Expect = 1.358e-8 Identity = 25/47 (53.19%), Postives = 36/47 (76.60%), Query Frame = 1 Query: 4 TLKESTHLTAVGHPQHDGSNSRIYTTRYEMSYSGSGWKIVEGAVLES 144 TL+ES L+ + HP+++ ++ R YTTRYE+ +S SGWKI EG+VL S Sbjct: 755 TLEESACLSDLVHPENNATDVRTYTTRYEVFWSKSGWKITEGSVLAS 801 The following BLAST results are available for this feature:
BLAST of GT623399 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 3
BLAST of GT623399 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT623399 ID=GT623399; Name=GT623399; organism=Lens culinaris; type=EST; length=319bpback to top |