GH720477
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720477 vs. TrEMBL
Match: C6T4E7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 2.297e-13 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = -1 Query: 69 RYLIGNDLKKLVERDVGRLVGIQCYRGIRHADGLPCRGQ 185 +YLIGNDLKK VERDVGRLVGIQCYRGIRH D LPCRGQ Sbjct: 91 KYLIGNDLKKCVERDVGRLVGIQCYRGIRHVDSLPCRGQ 129
BLAST of GH720477 vs. TrEMBL
Match: B9GUF7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_551504 PE=3 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.196e-7 Identity = 25/39 (64.10%), Postives = 30/39 (76.92%), Query Frame = -1 Query: 69 RYLIGNDLKKLVERDVGRLVGIQCYRGIRHADGLPCRGQ 185 +YL G DL + V+ DV RLV I+CYRG RH +GLPCRGQ Sbjct: 91 KYLTGPDLARRVKADVQRLVDIECYRGYRHVEGLPCRGQ 129
BLAST of GH720477 vs. TrEMBL
Match: A9PIG5_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.196e-7 Identity = 25/39 (64.10%), Postives = 30/39 (76.92%), Query Frame = -1 Query: 69 RYLIGNDLKKLVERDVGRLVGIQCYRGIRHADGLPCRGQ 185 +YL G DL + V+ DV RLV I+CYRG RH +GLPCRGQ Sbjct: 91 KYLTGPDLARRVKADVQRLVDIECYRGYRHVEGLPCRGQ 129
BLAST of GH720477 vs. SwissProt
Match: RT13_SOYBN (Small ribosomal subunit protein S13, mitochondrial OS=Glycine max GN=RSP13 PE=3 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 1.137e-14 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = -1 Query: 69 RYLIGNDLKKLVERDVGRLVGIQCYRGIRHADGLPCRGQ 185 +YLIGNDLKK VERDVGRLVGIQCYRGIRH D LPCRGQ Sbjct: 91 KYLIGNDLKKCVERDVGRLVGIQCYRGIRHVDSLPCRGQ 129
BLAST of GH720477 vs. SwissProt
Match: RT13_MARPO (Ribosomal protein S13, mitochondrial OS=Marchantia polymorpha GN=RPS13 PE=3 SV=2) HSP 1 Score: 53.5286 bits (127), Expect = 3.916e-7 Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = -1 Query: 69 YLIGNDLKKLVERDVGRLVGIQCYRGIRHADGLPCRGQ 182 YL+ ++LK++++RD+ RL+ I CYRG RH GLP RGQ Sbjct: 64 YLVDSELKRVIQRDIKRLISIGCYRGFRHNAGLPLRGQ 101
BLAST of GH720477 vs. TAIR peptide
Match: AT5G14320.1 (| Symbols: | Ribosomal protein S13/S18 family | chr5:4617839-4618772 REVERSE LENGTH=169) HSP 1 Score: 50.0618 bits (118), Expect = 3.345e-7 Identity = 21/39 (53.85%), Postives = 27/39 (69.23%), Query Frame = -1 Query: 69 RYLIGNDLKKLVERDVGRLVGIQCYRGIRHADGLPCRGQ 185 +Y+I DL++ + RL IQCYRG+RH GLPCRGQ Sbjct: 107 KYMIEGDLRRFNALAIKRLKEIQCYRGVRHIQGLPCRGQ 145 The following BLAST results are available for this feature:
BLAST of GH720477 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 3
BLAST of GH720477 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 2
BLAST of GH720477 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720477 ID=GH720477; Name=GH720477; organism=Pisum sativum; type=EST; length=200bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|