FG535475
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG535475 vs. TrEMBL
Match: B9GVY9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_799586 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.401e-7 Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 3 YIKYSVEDLEDAVLDFFEGIPVSQHTRRRSQ 95 YIKYSVEDLE+AVLDFFEG PVSQH RRRSQ Sbjct: 599 YIKYSVEDLENAVLDFFEGYPVSQHLRRRSQ 629
BLAST of FG535475 vs. TrEMBL
Match: B9N7F2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_785947 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.829e-7 Identity = 28/31 (90.32%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 3 YIKYSVEDLEDAVLDFFEGIPVSQHTRRRSQ 95 YIKYSVEDLE AVLDFFEG PVSQH RRRSQ Sbjct: 580 YIKYSVEDLESAVLDFFEGYPVSQHLRRRSQ 610
BLAST of FG535475 vs. TrEMBL
Match: B9T3B0_RICCO (Protein binding protein, putative OS=Ricinus communis GN=RCOM_0392160 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 3.120e-7 Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 3 YIKYSVEDLEDAVLDFFEGIPVSQHTRRRSQ 95 Y+KYSVEDLE+AVLDFFEG PVSQH RRRSQ Sbjct: 586 YMKYSVEDLENAVLDFFEGYPVSQHLRRRSQ 616 The following BLAST results are available for this feature:
BLAST of FG535475 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG535475 ID=FG535475; Name=FG535475; organism=Pisum sativum; type=EST; length=542bpback to top |