GH720684
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720684 vs. TrEMBL
Match: B9RC94_RICCO (RNA-binding protein nob1, putative OS=Ricinus communis GN=RCOM_1686350 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.596e-9 Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 2 Query: 212 QQVLEDARNRHGISVLIVDANAVIAGGDKLHGIADKFVSVPEVLEEIRD 358 Q +E ++ GIS+ ++DANAVI GG+KLH +ADKFV+VPEVL EIRD Sbjct: 39 QIFVESCKSSKGISMAVIDANAVIEGGEKLHNLADKFVTVPEVLAEIRD 87
BLAST of GH720684 vs. TrEMBL
Match: B9GWG3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_830830 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.390e-9 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 2 Query: 206 ETQQVLEDARNRHGISVLIVDANAVIAGGDKLHGIADKFVSVPEVLEEIRD 358 + Q +E ++ HGISV ++DANA+I GG+KL+ ADKF +VPEVL EIRD Sbjct: 35 QDQLYVESCKSTHGISVAVIDANAIIQGGEKLNNFADKFFTVPEVLAEIRD 85
BLAST of GH720684 vs. TAIR peptide
Match: AT5G41190.1 (| Symbols: | CONTAINS InterPro DOMAIN/s: Nin one binding (NOB1) Zn-ribbon like (InterPro:IPR014881), D-site 20S pre-rRNA nuclease (InterPro:IPR017117); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:16487628-16490012 REVERSE LENGTH=602) HSP 1 Score: 53.9138 bits (128), Expect = 2.754e-8 Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 2 Query: 227 DARNRHGISVLIVDANAVIAGGDKLHGIADKFVSVPEVLEEIRDTSA 367 + ++ GIS+ +VDANA+I G L ADKFV+VPEVL EIRD ++ Sbjct: 37 NCKSTKGISIAVVDANAIIEGRQSLTNFADKFVTVPEVLSEIRDPAS 83 The following BLAST results are available for this feature:
BLAST of GH720684 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of GH720684 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720684 ID=GH720684; Name=GH720684; organism=Pisum sativum; type=EST; length=377bpback to top |