GT625131
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT625131 vs. SwissProt
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 8.664e-7 Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = 2 Query: 2 KAYTVTFTSLGSTPQKVNGFGRLEWRNVKNVVGSPISISW 121 K+YTVTFT S P N FG +EW + K+VVGSP++ISW Sbjct: 717 KSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISW 756
BLAST of GT625131 vs. TAIR peptide
Match: AT5G67360.1 (| Symbols: ARA12 | Subtilase family protein | chr5:26872192-26874465 REVERSE LENGTH=757) HSP 1 Score: 52.373 bits (124), Expect = 6.789e-8 Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = 2 Query: 2 KAYTVTFTSLGSTPQKVNGFGRLEWRNVKNVVGSPISISW 121 K+YTVTFT S P N FG +EW + K+VVGSP++ISW Sbjct: 717 KSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISW 756 The following BLAST results are available for this feature:
BLAST of GT625131 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Swissprot) Total hits: 1
BLAST of GT625131 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT625131 ID=GT625131; Name=GT625131; organism=Lens culinaris; type=EST; length=274bpback to top |