GT620253
EST Overview
Unigenes
This EST is part of the following unigenes:
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GT620253 vs. TrEMBL
Match: B9SMV4_RICCO (Double-stranded RNA binding protein, putative OS=Ricinus communis GN=RCOM_0471170 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 9.405e-8 Identity = 23/40 (57.50%), Postives = 33/40 (82.50%), Query Frame = -3 Query: 365 ESKLYRSCIANHWKPPVFECCKEEGPHRCRMFTSKAIIEI 484 +S+L+ C+AN+WKPP++ECCKEEGP R+FT K I+E+ Sbjct: 131 KSQLHEICVANNWKPPLYECCKEEGPCHQRLFTFKVIVEM 170
BLAST of GT620253 vs. TrEMBL
Match: D7T528_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_149.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00001045001 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 3.574e-7 Identity = 22/41 (53.66%), Postives = 31/41 (75.61%), Query Frame = -3 Query: 362 ESKLYRSCIANHWKPPVFECCKEEGPHRCRMFTSKAIIEIE 484 ++++Y C AN+WKPP FECCKEEGP ++FT K ++IE Sbjct: 1540 KARMYEICAANYWKPPSFECCKEEGPSHLKLFTVKLTMKIE 1580
BLAST of GT620253 vs. SwissProt
Match: DCL4_ARATH (Dicer-like protein 4 OS=Arabidopsis thaliana GN=DCL4 PE=1 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.239e-7 Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = -3 Query: 362 ESKLYRSCIANHWKPPVFECCKEEGPHRCRMFTSKAIIEIE 484 +S L+ +C+AN WKPP FECC+EEGP + F K I+E+E Sbjct: 1510 KSLLHETCVANCWKPPHFECCEEEGPGHLKSFVYKVILEVE 1550
BLAST of GT620253 vs. SwissProt
Match: DCL4_ORYSJ (Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 4.706e-7 Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = -3 Query: 347 SKLYRSCIANHWKPPVFECCKEEGPHRCRMFTSKAIIEIETNKAS 481 S L+ C AN+WKPP F+ CKEEGP R FT K ++EI+ A+ Sbjct: 1572 SFLFELCAANYWKPPEFKLCKEEGPSHLRKFTYKVVVEIKGASAT 1616
BLAST of GT620253 vs. TAIR peptide
Match: AT5G20320.2 (| Symbols: DCL4 | dicer-like 4 | chr5:6859571-6869068 REVERSE LENGTH=1688) HSP 1 Score: 56.6102 bits (135), Expect = 1.277e-8 Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = -3 Query: 362 ESKLYRSCIANHWKPPVFECCKEEGPHRCRMFTSKAIIEIE 484 +S L+ +C+AN WKPP FECC+EEGP + F K I+E+E Sbjct: 1609 KSLLHETCVANCWKPPHFECCEEEGPGHLKSFVYKVILEVE 1649
BLAST of GT620253 vs. TAIR peptide
Match: AT5G20320.1 (| Symbols: DCL4, ATDCL4 | dicer-like 4 | chr5:6859571-6869068 REVERSE LENGTH=1702) HSP 1 Score: 56.6102 bits (135), Expect = 1.277e-8 Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = -3 Query: 362 ESKLYRSCIANHWKPPVFECCKEEGPHRCRMFTSKAIIEIE 484 +S L+ +C+AN WKPP FECC+EEGP + F K I+E+E Sbjct: 1623 KSLLHETCVANCWKPPHFECCEEEGPGHLKSFVYKVILEVE 1663 The following BLAST results are available for this feature:
BLAST of GT620253 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Trembl) Total hits: 2
BLAST of GT620253 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Lens culinaris unigene v1 vs Swissprot) Total hits: 2
BLAST of GT620253 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Lens culinaris unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Lens culinaris unigene v1
Date Performed: 2011-01-06
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GT620253 ID=GT620253; Name=GT620253; organism=Lens culinaris; type=EST; length=633bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|